Skip to content

Enfuvirtide

An FDA-approved synthetic 36-amino-acid peptide derived from the HR2 region of HIV-1 gp41. Enfuvirtide is the first-in-class HIV fusion inhibitor, given as a twice-daily subcutaneous injection in heavily treatment-experienced patients with multidrug-resistant HIV-1.

BStrongWell-Studied
Last updated 19 citations

What is Enfuvirtide?

Enfuvirtide (Fuzeon, T-20) is a synthetic 36-amino-acid peptide whose sequence is derived directly from residues 643-678 of the HR2 (heptad repeat 2) region of the HIV-1 envelope glycoprotein gp41. It was the first FDA-approved (March 13, 2003) HIV entry inhibitor and remains the only marketed peptide-based antiretroviral. Trimeris, a Duke University spinout founded by Dani Bolognesi, Tom Matthews, Carl Wild and Robert Lambert from the laboratory that first described HR2-derived gp41 peptides as fusion inhibitors, partnered with Roche to bring the molecule to market under the brand name Fuzeon. The drug works by mimicking the HR2 helix and binding to the transient HR1 trimer that forms after CD4/coreceptor engagement, preventing the gp41 ectodomain from collapsing into the six-helix bundle that drives viral-host membrane fusion. Enfuvirtide is administered as a 90 mg subcutaneous injection twice daily after reconstitution from a lyophilized powder in sterile water for injection. Once a flagship salvage therapy for multidrug-resistant HIV-1 in the early-2000s era of failing protease-inhibitor and reverse-transcriptase regimens, it has been largely displaced by oral integrase inhibitors (dolutegravir, bictegravir), the long-acting CD4 attachment inhibitor ibalizumab, the gp120 attachment inhibitor fostemsavir, and the capsid inhibitor lenacapavir, but it retains a niche in patients with limited remaining antiretroviral options where its non-overlapping mechanism preserves a usable activity profile.

What Enfuvirtide Is Investigated For

Enfuvirtide has one FDA-approved indication and a small set of clinical contexts where it is still actively used. The TORO program, TORO-1 (Lalezari et al., NEJM 2003) in North and South America and TORO-2 (Lazzarin et al., NEJM 2003) in Europe and Australia, randomized 995 heavily treatment-experienced HIV-1 patients in total to enfuvirtide plus an optimized background regimen versus optimized background alone. At 24 and 48 weeks, the enfuvirtide arms achieved roughly twice the rate of viral suppression below 400 copies/mL and a meaningfully greater drop in HIV-1 RNA log change, with durable benefit through the 96-week follow-up reported by Reynes and colleagues. The drug's role today is narrower than its launch envelope. Modern first- and second-line HIV therapy is built around oral integrase strand transfer inhibitors with bictegravir/emtricitabine/tenofovir alafenamide and dolutegravir-based combinations dominating; enfuvirtide's twice-daily injection schedule, near-universal injection-site reactions, and acquisition cost have pushed it into salvage and rescue settings. The CAPELLA program brought lenacapavir into the heavily treatment-experienced population in 2021-2023, and ibalizumab and fostemsavir provide additional non-overlapping mechanisms, but enfuvirtide remains a recognized component of optimized background regimens when its activity is preserved and other options are exhausted. The honest framing: it is one of the great mechanistic milestones of HIV therapeutics, and its real-world role today is small but not zero.

Salvage therapy in heavily treatment-experienced adults with multidrug-resistant HIV-1 who have failed multiple classes of antiretrovirals
Strong90%
Component of optimized background regimens to achieve and sustain virologic suppression in MDR HIV-1
Strong90%
Treatment of HIV-1 infection in pediatric patients aged 6 years and older with limited antiretroviral options
Moderate70%
Bridging therapy during construction of a new optimized regimen when active drugs in other classes are scarce
Moderate70%

History & Discovery

Enfuvirtide's lineage runs through the Duke University HIV laboratory of Dani Bolognesi and Tom Matthews, with critical contributions from Carl Wild and Robert Lambert in the early 1990s. Their 1994 PNAS paper (Wild et al., PMID 7937889) reported that synthetic peptides corresponding to a predicted alpha-helical domain of HIV-1 gp41, which they designated DP-107 (HR1-derived) and DP-178 (HR2-derived), were potent inhibitors of HIV-1 infection at low-nanomolar IC50 in cell-culture assays. The discovery emerged from a structural-bioinformatics insight: the gp41 sequence contained two heptad repeat regions with strong predicted alpha-helical and coiled-coil character, and synthetic peptides matching those regions might competitively block whatever conformational rearrangement gp41 needed to make during membrane fusion. The hypothesis was correct, and DP-178 in particular showed activity that justified clinical translation. The Duke team founded Trimeris in 1993 specifically to develop DP-178 as an HIV therapeutic. The molecule was renamed T-20 (its 20th synthetic peptide candidate in the development program), then pentafuside, and ultimately enfuvirtide. Trimeris partnered with Roche in 1999 to fund the expensive late-stage development and the unprecedented manufacturing scale-up that the molecule required. Producing a 36-amino-acid synthetic peptide at the metric-ton scale needed for global commercial supply was a significant industrial chemistry challenge: the original Trimeris/Roche manufacturing process involved over 100 chemical steps with multiple purifications, and the cost of goods at launch was reportedly the highest of any drug ever brought to market on a per-gram basis. Roche built a dedicated peptide manufacturing facility in Boulder, Colorado for enfuvirtide and the price set at launch, approximately US 20,000-25,000 dollars per patient per year, reflected those manufacturing economics and immediately constrained the patient population that could realistically access the drug. The structural rationale for enfuvirtide became clearer in parallel with its clinical development. Chan, Fass, Berger and Kim's 1997 Cell paper (PMID 9108481) crystallized the gp41 ectodomain core and revealed the six-helix bundle architecture: three HR1 helices in a central parallel coiled coil with three HR2 helices packed antiparallel into the outer grooves. Eckert and Kim's 1999 Cell paper (PMID 10520998) identified the deep HR1 hydrophobic pocket as a discrete druggable target. Together these structures explained exactly how DP-178 / T-20 worked: it competitively occupied the HR1 grooves that intramolecular HR2 needed to dock into, arresting the fusion machinery in the pre-hairpin intermediate. The clinical proof-of-concept came from Kilby and colleagues at the University of Alabama at Birmingham (Kilby et al., Nat Med 1998; PMID 9809555), who administered intravenous T-20 to 16 HIV-1-infected volunteers and observed rapid, dose-dependent reductions in plasma HIV-1 RNA, up to ~1.5 log10 copies/mL at the highest dose. This was the first demonstration that an HIV-1 entry step itself could be drugged in humans. The TORO-1 (Lalezari et al., NEJM 2003; PMID 12637625) and TORO-2 (Lazzarin et al., NEJM 2003; PMID 12773645) Phase III trials randomized a combined 995 heavily treatment-experienced HIV-1 patients to subcutaneous enfuvirtide 90 mg twice daily plus an optimized background regimen vs. optimized background alone. The enfuvirtide arms achieved roughly twice the rate of viral suppression and a substantially greater drop in HIV-1 RNA log change at 24 weeks. The benefit was durable through 48 (Nelson 2005, Trottier 2005) and 96 weeks (Reynes 2007). The FDA approved Fuzeon on March 13, 2003, with the European Medicines Agency following weeks later, a remarkably fast regulatory turnaround driven by the unmet need in patients with multidrug-resistant virus. In the years immediately after launch, enfuvirtide was hailed as a breakthrough for the salvage population. But the landscape moved quickly. The integrase inhibitor raltegravir was approved in 2007; the CCR5 antagonist maraviroc the same year; etravirine (a second-generation NNRTI active against multi-NNRTI-resistant virus) and darunavir (a high-barrier protease inhibitor) gave clinicians effective oral options for treatment-experienced patients. By the mid-2010s, dolutegravir-based regimens with very high genetic barriers to resistance had become standard, and the population requiring enfuvirtide-style salvage shrank dramatically. The 2018 approval of ibalizumab (a long-acting CD4 attachment-inhibiting monoclonal antibody), the 2020 approval of fostemsavir (an oral gp120 attachment inhibitor), and the 2022 approval of lenacapavir (a long-acting capsid inhibitor) further compressed enfuvirtide's niche. Roche continues to manufacture and distribute Fuzeon globally, but the drug's commercial footprint is a small fraction of what was projected at launch. Scientifically, enfuvirtide remains a landmark: the first peptide-based antiretroviral, the first HIV entry inhibitor, and a textbook validation that transient conformational intermediates of viral fusion proteins are druggable. Its lessons informed the design of follow-on HR2-mimetic peptides (sifuvirtide, albuvirtide), small-molecule entry inhibitors, and analogous strategies against other class-I fusion proteins (RSV, influenza HA, SARS-CoV-2 spike).

How It Works

HIV uses a surface protein called gp41 to fuse with human immune cells. After the virus latches onto a cell, gp41 has to fold up like a collapsing zipper: two parts of the protein, called HR1 and HR2, snap together into a bundle that pulls the virus and cell membranes together so the virus can dump its genetic material inside. Enfuvirtide is a synthetic copy of HR2 itself. It binds to the exposed HR1 zipper teeth before the real HR2 can get there, jamming the bundle and preventing the membranes from fusing. The virus stays outside the cell and never gets in.

Enfuvirtide's mechanism is a textbook example of inhibiting a transient conformational intermediate. HIV-1 entry begins when the surface glycoprotein gp120 engages CD4 on the target T cell, triggering a conformational change that exposes the gp120 V3 loop and allows gp120 to bind a chemokine coreceptor (CCR5 or CXCR4). This second binding event releases the transmembrane glycoprotein gp41 from its constrained pre-fusion state. The gp41 ectodomain transiently exposes a pre-hairpin intermediate in which two heptad repeat regions, HR1 (residues approximately 542-591, containing the leucine-zipper coiled-coil core) and HR2 (residues approximately 623-663), are projected outward but not yet associated with each other. In the final fusion-active conformation, three HR1 helices form a parallel trimeric coiled coil and three HR2 helices pack antiparallel against the outside of that core, generating a stable six-helix bundle that physically draws the viral and cellular membranes together for fusion. Enfuvirtide is a 36-residue synthetic peptide with the sequence YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF, corresponding to residues 643-678 of the gp41 HR2 region. The drug acts as a competitive HR2 mimic: it binds with high affinity to the exposed HR1 trimeric coiled coil during the pre-hairpin intermediate window, occupying the hydrophobic groove that the native HR2 helix would otherwise dock into. By competing with intramolecular HR2, enfuvirtide prevents formation of the six-helix bundle, arrests the gp41 fusion machinery in a non-productive intermediate, and blocks viral-host membrane fusion entirely. The structural rationale was established before enfuvirtide reached the clinic. Wild and colleagues at Duke (Wild et al., PNAS 1994; PMID 7937889) showed that synthetic peptides corresponding to a predicted alpha-helical domain of gp41, which they termed DP-107 (HR1-derived) and DP-178 (HR2-derived), were potent inhibitors of HIV infection at low-nanomolar IC50. DP-178 became T-20 and ultimately enfuvirtide. Chan and colleagues (Chan et al., Cell 1997; PMID 9108481) crystallized the gp41 ectodomain core, revealing the six-helix bundle architecture and identifying the HR1 hydrophobic pocket that is the binding target. Eckert and colleagues (Eckert et al., Cell 1999; PMID 10520998) extended this with D-peptide inhibitors targeting the same HR1 coiled-coil pocket. Kilby and colleagues' 1998 Nature Medicine paper (Kilby et al., Nat Med 1998; PMID 9809555) provided the first human demonstration that intravenous T-20 produced rapid, dose-dependent reductions in plasma HIV-1 RNA in 16 infected volunteers, establishing in vivo proof of concept for a peptide entry inhibitor. Resistance to enfuvirtide, as expected mechanistically, maps to HR1. Rimsky, Shugars and Matthews (J Virol 1998; PMID 9444991) demonstrated in vitro that point mutations in the HR1 segment (codons 36-45 of gp41, particularly G36D/E/S/V, V38A/E/M, Q40H, N42T and N43D) confer 5- to 100-fold reductions in enfuvirtide susceptibility by altering the hydrophobic groove that enfuvirtide docks into. The TORO baseline-and-on-treatment genotype/phenotype analysis by Melby and colleagues (Melby et al., AIDS Res Hum Retroviruses 2006; PMID 16706613) confirmed that virologic failure on enfuvirtide is closely associated with emergence of these HR1 escape mutations. The genetic barrier to resistance is correspondingly low, which is why enfuvirtide must be used with an optimized background regimen containing at least one other active drug. Pharmacokinetically, enfuvirtide's half-life of ~3.8 hours after subcutaneous injection supports twice-daily dosing; the molecule is bound primarily to plasma proteins and is cleared by proteolysis to its constituent amino acids. There is no hepatic CYP metabolism, no glucuronidation, and minimal renal excretion of intact drug, eliminating the typical pharmacokinetic drug-drug interaction concerns that complicate antiretroviral combinations.

Evidence Snapshot

Overall Confidence88%

Human Clinical Evidence

Strong. The TORO-1 and TORO-2 Phase III trials (Lalezari et al. and Lazzarin et al., NEJM 2003) randomized 995 heavily treatment-experienced HIV-1 patients to enfuvirtide plus optimized background regimen vs. optimized background alone, with 24-week, 48-week (Nelson 2005, Trottier 2005), and 96-week (Reynes 2007) follow-up demonstrating durable virologic and immunologic benefit. The pediatric pharmacokinetic data (Zhang 2007) and ISR studies (Loutfy 2007) round out a substantial human evidence base for an FDA-approved indication.

Animal / Preclinical

Thorough. Mechanism was established in cell-culture HIV-1 infection assays (Wild et al. 1994), gp41 ectodomain crystallography (Chan et al. 1997), and HR1-pocket D-peptide inhibition (Eckert et al. 1999). Resistance characterization was done in vitro and in vivo (Rimsky 1998, Melby 2006).

Mechanistic Rationale

Very strong. The six-helix bundle / pre-hairpin intermediate model of HIV-1 fusion is structurally resolved, and enfuvirtide's competitive HR2-mimic mechanism is one of the most clearly defined mechanisms in antiretroviral therapy.

Research Gaps & Open Questions

What the current literature has not yet settled about Enfuvirtide:

  • 01Optimal place in the modern heavily treatment-experienced (HTE) population alongside lenacapavir, ibalizumab, and fostemsavir has not been resolved by head-to-head trials; sequencing strategies and cross-resistance profiles remain primarily informed by observational data and resistance-analysis subsets like Margot et al. (CAPELLA 2023).
  • 02Long-term effects of cumulative injection-site reactions on subcutaneous tissue architecture (fibrotic nodule load, exhaustion of viable injection sites, impact on absorption variability) over many years of therapy have not been formally catalogued in modern cohorts.
  • 03Pediatric long-term safety beyond the 48-week pharmacokinetic window of Zhang 2007 is limited; growth, neurodevelopmental, and metabolic outcomes in children maintained on enfuvirtide for years have not been extensively studied.
  • 04Mechanism of the increased bacterial pneumonia signal observed in TORO (4.68 vs. 0.61 events per 100 patient-years in enfuvirtide vs. control arms) has not been fully resolved: whether it reflects chance, immune reconstitution dynamics, ISR-related skin barrier disruption, or a true pharmacological effect remains uncertain.
  • 05Long-acting peptide fusion inhibitor successors: albuvirtide (approved in China, weekly IV) and other depot HR2-mimetic candidates have not been compared head-to-head with enfuvirtide in registrational trials in Western populations.
  • 06Pre-exposure prophylaxis (PrEP) potential of long-acting fusion inhibitors derived from the enfuvirtide structural framework has been explored preclinically but not advanced clinically to compete with cabotegravir LA or lenacapavir LA PrEP.
  • 07Cost-effectiveness in the contemporary era, alongside lenacapavir, ibalizumab, and fostemsavir as competing salvage options, has not been comprehensively re-analyzed since the Sax 2005 estimates.

Forms & Administration

Enfuvirtide is supplied as a sterile lyophilized white powder in single-use vials containing 108 mg of drug (delivers 90 mg per dose after reconstitution). Each dose is reconstituted with 1.1 mL of sterile water for injection, gently swirled (not shaken) until fully dissolved: the reconstitution typically takes 30-45 minutes to complete because vigorous shaking can foam the peptide. The reconstituted solution delivers 90 mg in 1 mL via subcutaneous injection into the upper arm, anterior thigh, or abdomen, twice daily approximately 12 hours apart. Injection sites should be rotated systematically to minimize the cumulative burden of injection-site reactions, which are essentially universal. A needle-free Biojector 2000 gas-powered injection system was studied (Harris 2006, Loutfy 2007) and is FDA-cleared for enfuvirtide administration with comparable plasma levels and a different (but not absent) ISR profile. Once reconstituted, the solution should be administered immediately if possible, or refrigerated at 2-8 C and used within 24 hours. The pediatric dose (children 6 years and older) is weight-based at 2 mg/kg twice daily, up to a maximum of 90 mg per dose. There is no oral form, no long-acting depot form, and no transdermal form: the molecule's size and proteolytic susceptibility require the SC route. This is a prescription-only medication that must be used in combination with an optimized background regimen containing other active antiretrovirals; it is not appropriate for monotherapy under any circumstance.

Common Questions

Who Enfuvirtide Is NOT For

Contraindications
  • Known hypersensitivity to enfuvirtide or any component of the formulation. Hypersensitivity reactions (rash, fever, nausea, vomiting, chills, hypotension, elevated liver enzymes) have been described, and re-challenge after a hypersensitivity event is contraindicated.
  • Use as monotherapy or with a non-suppressive background regimen, which rapidly selects for HR1 escape mutations and is not an acceptable strategy under any circumstance.
  • Pregnancy and lactation: limited human data; use only when clearly necessary and under specialist HIV-care guidance. Enfuvirtide does not appear to cross the placenta in meaningful amounts, but the human evidence base is small.
  • Severe injection-site complications (e.g., extensive infected nodules, severe ISR-related disability) where continued therapy is no longer tolerable: discontinuation and substitution of an alternative active agent (e.g., lenacapavir, ibalizumab) should be considered.
  • Patients in whom subcutaneous absorption cannot be reasonably ensured (e.g., severe peripheral edema, advanced cachexia with no viable injection sites): alternative routes are not available for this molecule.

Drug & Supplement Interactions

Enfuvirtide is essentially free of clinically meaningful pharmacokinetic drug-drug interactions, which is a notable advantage in heavily treatment-experienced patients on complex regimens. The molecule is a 36-amino-acid peptide cleared by intravascular and intracellular proteolysis to its constituent amino acids, with no hepatic cytochrome P450 metabolism (no CYP3A4, CYP2D6, CYP2C9, or CYP1A2 substrate, inhibitor, or inducer activity), no glucuronidation, and minimal renal clearance of intact drug. Co-administration with ritonavir-boosted protease inhibitors, NNRTIs (efavirenz, etravirine, rilpivirine), integrase strand transfer inhibitors (dolutegravir, bictegravir, raltegravir), CCR5 antagonists (maraviroc), and the more recent entry inhibitors (ibalizumab, fostemsavir) and capsid inhibitor (lenacapavir) does not require dose adjustment of enfuvirtide or the partner agent based on shared metabolism. Pharmacodynamic interactions with other antiretrovirals are favorable: in vitro studies and clinical experience show additive or synergistic antiviral activity with most other HIV drug classes, and no antagonism. Routine concomitant medications (statins, antihypertensives, antidepressants, opioids, antibiotics, antifungals, antacids) likewise have no documented pharmacokinetic interaction with enfuvirtide. Clinically relevant pharmacodynamic considerations are limited to the additive bacterial-pneumonia signal observed in TORO and the cumulative subcutaneous-tissue burden of injection-site reactions over time. As always, the operative reference for specific interaction guidance is the institutional protocol and the current FDA prescribing information, not this summary.

Safety Profile

Safety Information

Common Side Effects

Injection-site reactions: near-universal (>98% of patients in TORO trials) and the dominant tolerability issue: pain, erythema, induration, nodules, cysts, pruritus, and ecchymosis at the injection site, persisting throughout therapy and sometimes leading to discontinuationDiarrheaNauseaFatigueInsomniaPeripheral neuropathyDecreased appetite and weight lossSinusitis and upper respiratory tract symptomsIncreased risk of bacterial pneumonia (signal observed in TORO trials, mechanism not fully understood)

Cautions

  • Hypersensitivity reactions (rash, fever, nausea, vomiting, chills, hypotension, elevated liver enzymes) described in approximately 1% of patients; re-challenge after a hypersensitivity event is contraindicated
  • Bacterial pneumonia incidence was higher in enfuvirtide arms in TORO-1 and TORO-2 (4.68 vs. 0.61 events per 100 patient-years); patients with risk factors for pneumonia should be monitored closely
  • Injection-site reactions are essentially universal: expectations and patient education are critical to adherence; rotation of injection sites and the Biojector needle-free device have been studied to mitigate the burden
  • Use only in combination with other active antiretrovirals: monotherapy or use with a non-suppressive background regimen rapidly selects HR1 escape mutations
  • Limited safety data in pregnancy; enfuvirtide does not appear to cross the placenta in meaningful amounts but human data are sparse
  • Limited data in patients with severe hepatic impairment; Child-Pugh C patients were excluded from registrational trials

What We Don't Know

Long-term effects of injection-site reactions on subcutaneous tissue architecture (cumulative cyst formation, fibrotic nodule load, eventual exhaustion of viable injection sites) over many years of therapy have not been formally catalogued in modern cohorts. Mechanism of the increased bacterial pneumonia signal seen in TORO is not fully understood and may relate to immune reconstitution, injection-site bacterial seeding, or chance. Optimal place in therapy alongside lenacapavir and ibalizumab in the contemporary heavily treatment-experienced population has not been fully resolved by head-to-head trials. Long-acting peptide fusion inhibitors (e.g., albuvirtide) have been developed and approved in some jurisdictions but have not displaced enfuvirtide globally.

Myths & Misconceptions

Myth

Enfuvirtide is no longer used because it doesn't work anymore.

Reality

Not true. Enfuvirtide still works against HIV-1 strains that lack HR1 escape mutations at codons 36-45 of gp41, and it retains a defined niche in salvage therapy for heavily treatment-experienced patients with multidrug-resistant virus and limited remaining options. Its declining use is driven by inconvenience (twice-daily SC injection), near-universal injection-site reactions, and high cost relative to modern oral integrase-based regimens, not by loss of antiviral activity. In appropriately selected patients today, it can still contribute meaningfully to virologic suppression as part of an optimized background regimen.

Myth

Enfuvirtide can be substituted for an oral HIV regimen for convenience.

Reality

It cannot. Enfuvirtide is exclusively a subcutaneous injection administered twice daily: there is no oral form, no transdermal form, and no long-acting depot form, because the molecule is a 36-amino-acid peptide that would be degraded by gastric and intestinal proteases. It is also never used as monotherapy: alone, or with a non-suppressive background regimen, it rapidly selects for HR1 escape mutations. It is a salvage component, not a convenience option, and the standard contemporary simple oral regimen is bictegravir/emtricitabine/tenofovir alafenamide or a dolutegravir-based combination.

Myth

The injection-site reactions are mild and improve over time.

Reality

They are essentially universal and persist throughout therapy. In the TORO-1 and TORO-2 trials, more than 98% of patients reported some form of injection-site reaction, and the majority reported nodules or cysts that did not resolve with continued therapy. Pain, induration, erythema, and pruritus are typical. Site rotation, training, and the Biojector needle-free device (Loutfy 2007) can mitigate severity but do not eliminate the problem. Patient education and realistic expectations are central to maintaining adherence over months to years of therapy.

Myth

Enfuvirtide interacts with other HIV drugs and complicates the regimen.

Reality

The opposite: enfuvirtide is essentially free of pharmacokinetic drug-drug interactions. Because it is a peptide cleared by proteolysis to amino acids, it is not metabolized by CYP enzymes, does not undergo glucuronidation, and is not significantly renally excreted as intact drug. This was a meaningful clinical advantage in the early-2000s salvage population, where patients were often on ritonavir-boosted protease inhibitors and complex multi-class regimens with their own CYP-mediated interactions. The clinically relevant considerations with enfuvirtide are pharmacodynamic (the bacterial-pneumonia signal seen in TORO, additive injection-site burden) rather than pharmacokinetic.

Myth

Enfuvirtide is a vaccine or immunotherapy because it's a peptide.

Reality

No, it is a small-molecule-style direct-acting antiviral that happens to be a peptide. Enfuvirtide does not stimulate an immune response, does not generate antibodies against HIV, and does not modulate T-cell function. Its mechanism is purely competitive: it binds the exposed HR1 trimer of gp41 during the transient pre-hairpin intermediate of viral fusion and prevents formation of the six-helix bundle that drives membrane fusion. The drug class it belongs to, fusion/entry inhibitors, is conceptually closer to receptor-blocking small molecules than to vaccines or therapeutic antibodies, despite the peptide chemistry.

Published Research

19 studies

Cross-resistance to entry inhibitors and lenacapavir resistance through Week 52 in study CAPELLA.

Resistance AnalysisPMID: 38085652

A large prospective study assessing injection site reactions, quality of life and preference in patients using the Biojector vs standard needles for enfuvirtide administration.

Loutfy et al., HIV Med 2007. Large prospective comparison of the Biojector needle-free device vs. conventional needles for enfuvirtide administration. Patients preferred the Biojector and reported reduced ISR severity in some metrics, though the device introduced its own pattern of bruising. Documents the central role of ISR in enfuvirtide tolerability and quality of life.

Clinical StudyPMID: 17760734

TORO: ninety-six-week virologic and immunologic response and safety evaluation of enfuvirtide with an optimized background of antiretrovirals.

Reynes et al., AIDS Patient Care STDS 2007. 96-week pooled TORO-1/TORO-2 analysis. Established durable long-term efficacy and tolerability of enfuvirtide-containing regimens in heavily treatment-experienced patients out to nearly two years, with the injection-site reaction profile remaining the dominant tolerability issue.

Randomized Controlled TrialPMID: 17711378

HIV entry inhibitors.

Este and Telenti, Lancet 2007. Authoritative overview of the HIV entry-inhibitor landscape: enfuvirtide as the first-in-class fusion inhibitor, maraviroc as the first CCR5 antagonist, and emerging agents targeting CD4 attachment, coreceptor binding, and the gp41 fusion intermediate. Useful framing of where enfuvirtide sits within the broader entry-inhibitor strategy.

ReviewPMID: 17617275

Population pharmacokinetics of enfuvirtide in HIV-1-infected pediatric patients over 48 weeks of treatment.

Zhang et al., J Clin Pharmacol 2007. Population pharmacokinetic analysis of enfuvirtide in HIV-1-infected pediatric patients over 48 weeks. Supports the weight-based 2 mg/kg twice-daily dosing (max 90 mg) used in children aged 6 years and older, the basis for the pediatric label expansion.

Pharmacokinetic StudyPMID: 17389560

Characterization of envelope glycoprotein gp41 genotype and phenotypic susceptibility to enfuvirtide at baseline and on treatment in the phase III clinical trials TORO-1 and TORO-2.

Melby et al., AIDS Res Hum Retroviruses 2006. The TORO-program resistance analysis. Documented that virologic failure on enfuvirtide was almost universally associated with emergence of HR1 mutations at codons 36-45 of gp41 (G36D/E/S/V, V38A/E/M, Q40H, N42T, N43D), with phenotypic susceptibility falling 5-100-fold or more, confirming the in vitro escape pattern from Rimsky 1998.

Resistance AnalysisPMID: 16706613

Enfuvirtide plasma levels and injection site reactions using a needle-free gas-powered injection system (Biojector).

Clinical StudyPMID: 16514302

Week-12 response to therapy as a predictor of week 24, 48, and 96 outcome in patients receiving the HIV fusion inhibitor enfuvirtide in the T-20 versus Optimized Regimen Only (TORO) trials.

Randomized Controlled TrialPMID: 16477567

Safety of enfuvirtide in combination with an optimized background of antiretrovirals in treatment-experienced HIV-1-infected adults over 48 weeks.

Randomized Controlled TrialPMID: 16280695

Durable efficacy of enfuvirtide over 48 weeks in heavily treatment-experienced HIV-1-infected patients in the T-20 versus optimized background regimen only 1 and 2 clinical trials.

Nelson et al., JAIDS 2005. Pooled 48-week analysis of TORO-1 and TORO-2 demonstrating that the virologic and immunologic benefit observed at 24 weeks was sustained through 48 weeks, with significantly greater rates of HIV-1 RNA <50 copies/mL and CD4 cell increase in the enfuvirtide arm.

Randomized Controlled TrialPMID: 16280694

Cost-effectiveness of enfuvirtide in treatment-experienced patients with advanced HIV disease.

Sax et al., JAIDS 2005. Cost-effectiveness analysis of adding enfuvirtide to optimized background regimens in heavily treatment-experienced patients with advanced HIV disease. Estimated incremental cost-effectiveness ratios were higher than most antiretroviral regimens, reflecting both the meaningful clinical benefit in MDR HIV and the high acquisition cost that has shaped enfuvirtide's restricted real-world role.

Cost-Effectiveness AnalysisPMID: 15851916

Enfuvirtide.

ReviewPMID: 14664654

Efficacy of enfuvirtide in patients infected with drug-resistant HIV-1 in Europe and Australia.

Lazzarin et al., NEJM 2003: the TORO-2 trial. Parallel Phase III trial of 504 heavily treatment-experienced HIV-1 patients in Europe and Australia. Same design as TORO-1 with comparable results: enfuvirtide added to optimized background substantially improved virologic outcomes at 24 weeks. Together with TORO-1, established the registrational evidence for FDA approval in March 2003.

Randomized Controlled TrialPMID: 12773645

Enfuvirtide, an HIV-1 fusion inhibitor, for drug-resistant HIV infection in North and South America.

Lalezari et al., NEJM 2003: the TORO-1 trial. Randomized 491 heavily treatment-experienced HIV-1 patients in North and South America to enfuvirtide plus optimized background regimen (OBR) vs. OBR alone. At 24 weeks, the enfuvirtide arm achieved significantly greater HIV-1 RNA reduction (-1.696 vs. -0.764 log10 copies/mL) and higher rates of suppression below 400 copies/mL. One of the two pivotal Phase III trials supporting FDA approval.

Randomized Controlled TrialPMID: 12637625

Inhibiting HIV-1 entry: discovery of D-peptide inhibitors that target the gp41 coiled-coil pocket.

Eckert, Malashkevich, Hong, Carr, and Kim, Cell 1999. Identified the deep hydrophobic pocket on the HR1 trimeric coiled coil and validated it as a small-molecule and D-peptide drug target. Reinforced the structural rationale for HR2-mimetic peptides like enfuvirtide and laid groundwork for next-generation fusion inhibitors.

PreclinicalPMID: 10520998

Potent suppression of HIV-1 replication in humans by T-20, a peptide inhibitor of gp41-mediated virus entry.

Kilby et al., Nature Medicine 1998. First human demonstration that T-20 (later enfuvirtide), administered by intravenous infusion to 16 HIV-1-infected volunteers, produced rapid, dose-dependent reductions in plasma HIV-1 RNA, up to a ~1.5 log10 drop at the highest dose over 14 days. The pivotal in vivo proof-of-concept paper that motivated full clinical development.

Clinical TrialPMID: 9809555

Determinants of human immunodeficiency virus type 1 resistance to gp41-derived inhibitory peptides.

Rimsky, Shugars, and Matthews, J Virol 1998. In vitro selection and characterization of HIV-1 variants resistant to DP-178 (T-20) and DP-107. Identified point mutations at codons 36-38 of gp41 (notably G36D and V38M) as the dominant resistance pathway, with reduced susceptibility of 5-100-fold. The mechanistic basis for the HR1 escape pattern subsequently observed in TORO and other clinical studies.

PreclinicalPMID: 9444991

Core structure of gp41 from the HIV envelope glycoprotein.

Chan, Fass, Berger, and Kim, Cell 1997. Crystal structure of the HIV-1 gp41 ectodomain core revealing the trimer of HR1-HR2 hairpins forming the six-helix bundle, with HR1 helices in a central parallel coiled coil and HR2 helices packed antiparallel against the outside grooves. The structural framework that explains why HR2-mimetic peptides like T-20 work and where they bind.

PreclinicalPMID: 9108481

Peptides corresponding to a predictive alpha-helical domain of human immunodeficiency virus type 1 gp41 are potent inhibitors of virus infection.

The seminal 1994 PNAS paper by Wild, Shugars, Greenwell, McDanal, and Matthews at Duke. First demonstration that synthetic peptides corresponding to the predicted alpha-helical HR1 (DP-107) and HR2 (DP-178) regions of gp41 are potent inhibitors of HIV-1 infection at low-nanomolar IC50. DP-178 from this paper became T-20 and ultimately enfuvirtide, the foundational mechanistic and structural rationale for the entire HIV fusion-inhibitor class.

PreclinicalPMID: 7937889

Quick Facts

Class
HIV Fusion Inhibitor
Tier
B
Evidence
Strong
Safety
Well-Studied
Updated
Apr 2026
Citations
19PubMed

Also known as

FuzeonT-20pentafusideDP-178

Tags

FDA-ApprovedAntiviralHIVFusion Inhibitorgp41SubcutaneousSalvage Therapy

Evidence Score

Overall Confidence88%

Clinical Trials

View Clinical Trials

Links to ClinicalTrials.gov for reference. Listing does not imply endorsement.